Share:
Iraq War

Iraq War

/ 2009 Views
About this Topic
Remove this Ad

On the Ground: U.S. Training Efforts Build Self-sufficiency in Iraq

Mar 17, 2009 12:58 AM

Uploaded by: DVIDSHUB - Views: 414

NYTimes: Iran and Iraq since 1981 (Radial) - White

Feb 5, 2009 10:17 PM

Uploaded by: blprnt_van - Views: 2235

U.S. Soldiers Clear Owja Desert of Iraq

Oct 10, 2008 12:02 PM

Uploaded by: DVIDS247 - Views: 283

"I haven't really focused much on the war in Iraq."

Sep 7, 2008 12:44 AM

Uploaded by: Gwynedd Tags: money poster lyrics heart quote lol iraq oil campaign barracuda gloriasteinem antichoice johnmccain antienvironmentalist quoted stepfordwives wolfkiller sarahpalin shesca...

Dipity Timeline Created

Aug 11, 2008 2:28 AM

The Creation of "Iraq"

Jul 16, 2008 7:55 PM

Uploaded by: Shannon Ocean Tags: sculpture iraqViews: 72

zoriah_iraq_war_anbar_marines_suicide_bomb_bombing_embed_aqi_al_qaeda_search

Jun 29, 2008 4:58 PM

Uploaded by: Zoriah - Views: 753

zoriah_iraq_war_fallujah_suicide_bomb_man_horror_grief

Jun 26, 2008 8:28 AM

Uploaded by: Zoriah Tags: foto fotograf fotografie bild fotógrafo imagen beeld reportage fotografía documental journaliste fotographie fotograaf documentaire fotoreporter reportaje dokumentarfilm r...

zoriah_iraq_war_fallujah_suicide_bomb_dead_elderly_old_man_sheik_chair

Jun 26, 2008 8:22 AM

Uploaded by: Zoriah Tags: photo américa foto fotograf photographie image iraq guerra krieg militar baghdad bild amerika guerre fotógrafo imagen bagdad armee reportage armée estadosunidos cuadro unf...

zoriah_iraq_war_conflict_baghdad_US_american_soldier_army_tattoo_forgive_me

Jun 15, 2008 12:15 PM

Uploaded by: Zoriah Tags: foto fotograf fotografie photographie iraq guerra krieg fotografia guerre fotógrafo fotografo irak fotografía photographe fotografering oorlog 日本語 fotographie fotograaf фо...

zoriah_iraq_war_baghdad_weapons_cache_ak_47_raid_search_siezure

Jun 9, 2008 4:24 AM

Uploaded by: Zoriah Tags: foto fotograf fotografie photographie iraq guerra krieg fotografia guerre fotógrafo fotografo fotografía photographe fotografering oorlog 日本語 fotographie fotograaf фотогра...

zoriah_iraq_war_baghdad_soldiers_mission_night_cards

Jun 7, 2008 5:48 PM

Uploaded by: Zoriah Tags: army fight war military iraq baghdad sadrcity zoriah conflictiraqwarbaghdadiraqViews: 427

zoriah_iraq_war_baghdad_soldiers_mission_sand_storm_Iraqi_woman

Jun 7, 2008 11:44 AM

Uploaded by: Zoriah Tags: city wall photography photo war iraq hijab photojournalism documentary baghdad conflict barrier sadr chador zoriahViews: 969

zoriah_iraq_war_baghdad_sadr_city_army_blackout

Jun 6, 2008 3:05 PM

Uploaded by: Zoriah Tags: army fight war military iraq baghdad sadrcity zoriah conflictiraqwarbaghdadiraqViews: 268

zoriah_iraq_war_kuwait_army_aircraft

Jun 2, 2008 7:14 AM

Uploaded by: Zoriah Tags: usa army us war military iraq baghdad kuwait zoriahViews: 277

zoriah_iraq_memorial_crosses

Mar 31, 2008 12:13 AM

Uploaded by: Zoriah Tags: new up sign work for this is blog image you iraq can email follow part current alerts feeds experiences zoriahnet wwwzoriahnetViews: 315

iraq

Mar 30, 2008 8:09 PM

Uploaded by: soldiersmediacenter Tags: soldiers usarmy iraq5 wwwarmymil ckharmyunclassified mahmuhdiyah fobmahmuhdiyahViews: 614

iraq

Mar 25, 2008 11:31 AM

Uploaded by: Army.mil - Views: 569

Bank of America security giving me the finger during the Iraq war protest

Mar 19, 2008 2:07 PM

Uploaded by: Steve Rhodes Tags: sanfrancisco california ca hat hands war uniform gun hand market fuck finger iraq fingers guard protest thefinger bank security boa fuckyou cap bankofamerica guns gu...

iraq

Mar 12, 2008 7:07 AM

Uploaded by: Army.mil - Views: 2055

iraq

Mar 10, 2008 2:10 PM

Uploaded by: soldiersmediacenter Tags: soldiers usarmy iraq1 wwwarmymil nxjairforceunclassified zambraniyahViews: 2075

iraq

Feb 18, 2008 8:39 AM

Uploaded by: Army.mil - Views: 4551

iraq

Jan 26, 2008 1:23 PM

Uploaded by: soldiersmediacenter Tags: military baghdad usarmy waronterror rusafa wwwarmymil iraq2 1ctcs504thairborne504thparachuteinfantryregime82ndairborneairbornealjarmybaghdaddismountdismounted...

iraq

Nov 16, 2007 12:03 PM

Uploaded by: soldiersmediacenter Tags: iraq helicopter soldiers usarmy camptaji 1stcavalrydivision wwwarmymil 227thaviationregiment 1staircavalrybrigade amoftwoah64dapachesfromthe1stbattalionViews:...

Iraq kit

Nov 7, 2007 6:13 AM

Uploaded by: magnumti_g4 Tags: strobist antennamod cactusv2s iraqstrobistkitViews: 1374

Ishtar Gate, Iraq

Nov 6, 2007 1:13 PM

Uploaded by: Wonders  Tags: ancienthistory iraq ancientcivilization archeology babylon mesopotamia babylonian towerofbabel ishtargate ancientworld babilônia iraque wondersoftheworld nabucodonosor w...

A-10C Thunderbolt, Al Asad AB, Iraq

Oct 26, 2007 11:30 PM

Uploaded by: James Gordon Tags: u2 apache cobra f14 iraq f16 helicopter f22 blackhawk predator uav dhl ch53 f15 fa18 ch47 uh60 av8b f23 hh60 iraqiairways supercobra coalitionaircraftiniraq iraqiair...

Babylon, Ancient Iraq

Oct 26, 2007 9:49 PM

Uploaded by: Wonders  Tags: ancienthistory iraq ancientcivilization archeology babylon mesopotamia babylonian towerofbabel ishtargate ancientworld babilônia iraque wondersoftheworld nabucodonosor w...

Babylon, Ancient Iraq

Oct 23, 2007 7:58 PM

Uploaded by: Wonders  Tags: ancienthistory iraq ancientcivilization archeology babylon mesopotamia babel babylonian ishtargate ancientworld babilônia iraque wondersoftheworld worldwonders babylone ...

Bush Sees Progress in Iraq, Unicorns

Oct 11, 2007 11:16 PM

Uploaded by: The Searcher Tags: art illustration sketch bush war comic rice drawing dick president georgebush political politics satire iraq cartoon progress derek illusion fantasy cover comicbook ...

Play day in Iraq.

Sep 28, 2007 6:23 AM

Uploaded by: gustaf wallen Tags: boy girl children play searchthebest iraq abigfave impressedbeauty aplusphoto superbmasterpiece playdayiniraqViews: 762

iraq

Sep 19, 2007 8:48 AM

Uploaded by: soldiersmediacenter Tags: mudwrestle reup reenlist iraqwwwarmymilusarmy soldiersdiyalaprovincemilitaryViews: 1954

Peace, Iraq War Protest, San Francisco

Sep 18, 2007 5:06 PM

Uploaded by: mdsea923 Tags: sanfrancisco ca march san francisco war peace unitedstates iraq rally protest demonstration antiwar iraqwarprotestViews: 4523

Iraq War (Windows of Suffering #10)

Sep 15, 2007 6:34 PM

Uploaded by: David Lewis-Baker Tags: usa david art collage youth america geotagged photography death media war emotion destruction islam georgebush political politics iraq religion suicide apocalyp...

Iraq War (Windows of Suffering #8)

Sep 15, 2007 6:33 PM

Uploaded by: David Lewis-Baker Tags: iraqwarwindows suffering iraq war windowshumaniariandeathmediaimagesartphotographycollagepoliticspatrotismnationalismfundmentalismdavid lewisbakerdavidlewisbake...

Iraq War (Windows of Suffering #5)

Sep 15, 2007 6:33 PM

Uploaded by: David Lewis-Baker Tags: david art geotagged death media images geotag lewisbaker davidlewisbaker iraqwarwindows sufferinghumaniarian photographycollagepoliticspartiorismnationalismconc...

Iraq War (Windows of Suffering #14)

Sep 15, 2007 6:33 PM

Uploaded by: David Lewis-Baker - Views: 7334

Iraq War (Windows of Suffering #5)

Sep 15, 2007 6:33 PM

Uploaded by: David Lewis-Baker - Views: 1302

Iraq War (Windows of Suffering #13)

Sep 15, 2007 6:32 PM

Uploaded by: David Lewis-Baker Tags: david art geotagged death media images geotag lewisbaker davidlewisbaker iraqwarwindows sufferinghumaniarian photographycollagepoliticspartiorismnationalismconc...

iraq

Sep 11, 2007 9:49 AM

Uploaded by: soldiersmediacenter Tags: soldier army baghdad soldiers usarmy adhamiya iraq2copwareagle319thairbornefieldartilleryregiment usarmysoldiersmilitarywwwarmymilwaronterroriraqViews: 1019

iraq

Sep 3, 2007 4:24 PM

Uploaded by: Army.mil - Views: 1477

iraq

Aug 31, 2007 2:28 AM

Uploaded by: soldiersmediacenter Tags: soldier army soldiers usarmy iraq3javillage3rdinfantrydivision jaara combatoutpostclearyusarmysoldiersmilitarywwwarmymilwaronterroriraqViews: 4082

iraq

Aug 30, 2007 10:04 PM

Uploaded by: Army.mil - Views: 2543

iraq

Aug 21, 2007 12:28 PM

Uploaded by: soldiersmediacenter Tags: soldier army iraq rr abraham soldiers ur ziggurat usarmy aliairbase wwwarmymilmilitaryusarmysoldiers iraq3aliairbaseViews: 3371

zoriah_iraq_war_military_army_us_airplain_fligh_biap_kuwat

Aug 6, 2007 10:15 AM

Uploaded by: Zoriah Tags: usa army us war military iraq baghdad kuwait zoriahViews: 274

iraq

Jul 31, 2007 10:20 AM

Uploaded by: Army.mil - Views: 1350

iraq

Jul 23, 2007 12:13 PM

Uploaded by: soldiersmediacenter Tags: training iraq iraqipolice militaryusarmysoldierswwwarmymilmilitaryiraqipoliceramadiiraq4campramadisoldierViews: 11912

iraq

Jul 17, 2007 8:25 AM

Uploaded by: soldiersmediacenter Tags: soldier iraq pace usarmy wwwarmymil soldiersiraqramadi genpaceViews: 2870

Bush's Iraq War Fodder's Last Heart-to-Heart With Rubber Ducky Before Deployment

Jul 15, 2007 3:56 PM

Uploaded by: casual clicks Tags: pool yellow swim bush war iraq rubber ducky waste fodder ihategeorgebush casualclicks jefflowe jefflowephotography jefflowephotographycomViews: 1991

iraq

Jul 12, 2007 6:56 PM

Uploaded by: soldiersmediacenter Tags: soldier usarmy wwwarmymil soldiersiraq5baghdadmansourViews: 1775

iraq

Jul 11, 2007 10:29 PM

Uploaded by: Army.mil - Views: 2139

iraq

Jul 11, 2007 9:47 PM

Uploaded by: Army.mil - Views: 4804

King Farouk ,Queen Farida and King Faisal of Iraq

Jul 11, 2007 5:16 PM

Uploaded by: Kodak Agfa - Views: 4527

iraq

Jul 8, 2007 6:28 PM

Uploaded by: Army.mil - Views: 2493

iraq

Jun 30, 2007 5:27 PM

Uploaded by: soldiersmediacenter Tags: iraq helicopter wwwarmymilusarmysoldiersmilitary 25thcombataviationbrigadeViews: 3189

iraq

Jun 26, 2007 2:58 AM

Uploaded by: soldiersmediacenter Tags: soldier usarmy wwwarmymil soldiersiraq4baghdadiraqViews: 4311

iraq

Jun 21, 2007 1:28 AM

Uploaded by: Army.mil - Views: 2271

iraq

Jun 18, 2007 2:57 PM

Uploaded by: Army.mil - Views: 1935

iraq

Jun 16, 2007 1:55 AM

Uploaded by: Army.mil - Views: 1933

iraq

Jun 15, 2007 7:33 PM

Uploaded by: soldiersmediacenter Tags: iraq helicopter wwwarmymilusarmysoldiersmilitary 25thcombataviationbrigadeViews: 1540

Aussie Troops in Iraq

Jun 10, 2007 4:56 PM

Uploaded by: Seeing It Through My Eyes Tags: soldier war flag military iraq australian guns fighting troops aussies wariniraq tallil 10millionphotos cmwdblueViews: 713

The People of Iraq are Suffering

Jun 6, 2007 12:47 PM

Uploaded by: Robert Whitlock Tags: love justice washington war peace military iraq protest badge tacoma aggression invasion weapons occupation fortlewis belligerent specialoperations ftlewis unifor...

iraq

Jun 2, 2007 5:23 AM

Uploaded by: Army.mil - Views: 2856

9/11 = Iraq

May 28, 2007 11:40 AM

Uploaded by: cubiccavepearls - Views: 19898

iraq

May 17, 2007 1:08 AM

Uploaded by: soldiersmediacenter Tags: iraq wwwarmymilmilitaryusarmysoldiersiraq1blackhawkhelicopteralasadairbaseiraqrescueairambulance45thmedicalcompanyuh60soldierarmyViews: 2222

iraq

May 14, 2007 11:41 AM

Uploaded by: soldiersmediacenter Tags: soldier iraq usarmy wwwarmymil soldiersiraq1yusufiyahViews: 1444

Sitting on Iraq's death row is a 25-year-old woman

May 10, 2007 5:25 AM

Uploaded by: Only You Only You Only You Tags: woman death is sitting row iraqs 25yearoldViews: 2565

iraq

May 8, 2007 9:18 AM

Uploaded by: soldiersmediacenter Tags: soldier usarmy wwwarmymil soldiersiraq5baghdadcamplibertyirqViews: 4017

A Wife Welcomes Her Husband Home from Iraq, at Camp Pendleton in San Diego

Apr 28, 2007 4:10 PM

Uploaded by: Scandblue Tags: usa inspiration love usmc america hug kiss couple military iraq happiness homecoming godblessamerica patriotism embrace welcomehome camppendleton homefromiraq ultimates...

A Marine Dad Greets His Baby Daughter Upon His Return Home from Iraq

Apr 28, 2007 4:07 PM

Uploaded by: Scandblue Tags: usa love usmc america dad unitedstates sandiego military father iraq daughter happiness homecoming marines pendleton welcomehome hmla367 happinessconservancyViews: 2430

A Wife Runs to Her Husband Upon His Arrival Home from Iraq, Camp Pendleton, San Diego (Explore)

Apr 28, 2007 4:04 PM

Uploaded by: Scandblue Tags: usa usmc america unitedstates sandiego military iraq homecoming marines greeting welcomehome camppendleton allyouneedislove comehomesoon hmla367 happinessconsrvancy fay...

iraq

Apr 20, 2007 7:06 AM

Uploaded by: soldiersmediacenter Tags: gates iraq helicopter blackhawk usarmy wwwarmymil soldiersiraq2baghdadViews: 2175

No Known Restrictions: Karbala, Iraq from Matson Collection, 1932 (LOC)

Apr 17, 2007 12:30 PM

Uploaded by: pingnews.com Tags: blackandwhite bw history public architecture digital vintage design photo foto unitedstates image library space islam iraq religion stock archive middleeast architec...

Mosul, Iraq from Matson Collection, 1932 (LOC)

Apr 17, 2007 12:28 PM

Uploaded by: pingnews.com Tags: people blackandwhite bw history public digital 1932 vintage photo war foto unitedstates image market library islam iraq religion stock archive middleeast east market...

Iraq Market from Matson Collection, 1932 (LOC)

Apr 17, 2007 12:14 PM

Uploaded by: pingnews.com Tags: people blackandwhite bw history public shop digital 1932 vintage photo war foto unitedstates image market library islam iraq religion stock archive middleeast east l...

No Known Restrictions: Karbala Mosque, Iraq from Matson Collection, 1932 (LOC)

Apr 17, 2007 12:05 PM

Uploaded by: pingnews.com Tags: blackandwhite bw history public architecture digital 1932 vintage design photo foto exterior unitedstates image library space islam iraq religion stock archive middl...

No Known Restrictions: "Ishtar Gate," Iraq from Matson Collection, 1932 (LOC)

Apr 17, 2007 12:02 PM

Uploaded by: pingnews.com Tags: blackandwhite bw history public architecture digital 1932 vintage design photo gate foto unitedstates image library space islam iraq religion stock archive middleeas...

No Known Restrictions: Babylon Basalt Lion, Iraq from Matson Collection, 1932 (LOC)

Apr 17, 2007 12:01 PM

Uploaded by: pingnews.com Tags: blackandwhite bw history public architecture digital 1932 vintage design photo foto unitedstates image library space islam iraq religion stock lion archive middleeas...

Iraq: U.S. Marines Hunt Down Insurgents

Apr 10, 2007 6:40 PM

Uploaded by: panzerwaffen43 Tags: 1st iraq read marines 31 3rd lucian fallujah battalion lr004Views: 11428

iraq

Apr 10, 2007 8:26 AM

Uploaded by: soldiersmediacenter Tags: dog army military iraq usarmy wwwarmymil soldiersiraq3diyalaprovincebaqubahirqViews: 2124

iraq

Apr 9, 2007 10:49 PM

Uploaded by: soldiersmediacenter Tags: dog soldier paw iraq shake handshake usarmy workingdog wwwarmymil soldiersiraq3diyalaprovincebaqubahirqViews: 8141

iraq

Apr 7, 2007 9:29 AM

Uploaded by: soldiersmediacenter Tags: senior bradley usarmy airman lail wwwarmymil soldiersiraq3kirkukkirkukregionalairbaseViews: 4500

iraq

Apr 6, 2007 5:43 PM

Uploaded by: soldiersmediacenter Tags: soldier engine maintenance usarmy wwwarmymil soldiersiraq1assadahViews: 4588

iraq

Apr 5, 2007 5:14 PM

Uploaded by: soldiersmediacenter Tags: soldier army iraq brave usarmy wwwarmymil soldiersiraq8baghdadViews: 3624

iraq

Apr 4, 2007 2:26 PM

Uploaded by: soldiersmediacenter Tags: soldier iraq usarmy wwwarmymil soldiersiraq3mosulcampmarezViews: 1869

Map of Iraq in the desert

Apr 3, 2007 3:55 PM

Uploaded by: Salwan ALabdaly سلوان العبدلي - Views: 265

iraq

Apr 2, 2007 3:18 AM

Uploaded by: Army.mil - Views: 6890

Public Domain: U.S. Soldier Baqubah, Iraq by Staff Sgt. Stacy L. Pearsall (DOD 070331-F-7234P-137)

Mar 31, 2007 2:55 AM

Uploaded by: pingnews.com Tags: news public digital soldier us photo media war foto unitedstates image library military iraq stock 911 archive middleeast free police east september11 middle dod arc...

iraq

Mar 26, 2007 9:38 PM

Uploaded by: soldiersmediacenter Tags: soldier iraq usarmy wwwarmymil soldiersiraq5fobwarriorViews: 2661

iraq

Mar 21, 2007 10:14 AM

Uploaded by: Army.mil - Views: 1972

iraq

Mar 20, 2007 6:49 AM

Uploaded by: soldiersmediacenter Tags: soldier iraq usarmy wwwarmymil womensoldier soldiersiraq1campramadiViews: 3370

iraq

Mar 20, 2007 2:00 AM

Uploaded by: soldiersmediacenter Tags: iraq soldiers usarmy wwwarmymil diyalairaq3diyalaprovinceoldbaqubahirqViews: 2397

iraq

Mar 14, 2007 7:38 AM

Uploaded by: Army.mil - Views: 4785

iraq

Mar 12, 2007 10:45 PM

Uploaded by: soldiersmediacenter Tags: silhouette iraq usarmy wwwarmymil soldiersiraq3fobmchenryViews: 2741

iraq

Mar 11, 2007 10:53 PM

Uploaded by: soldiersmediacenter Tags: usarmy wwwarmymil soldiersiraq3fobmchenryViews: 4637

Public Domain: Soldier & Child in Iraq, March 2007 by Andy Dunaway, U.S. Air Force(DOD 070308-F-2828D-389)

Mar 8, 2007 4:56 AM

Uploaded by: pingnews.com Tags: people news public youth digital children soldier us photo media war foto child unitedstates image library military iraq stock 911 young archive middleeast free east...

Leaving Iraq

Feb 12, 2007 12:38 AM

Uploaded by: versso Tags: army war military iraq kuwait deploy oif redeployViews: 2314

Jan 27th March on Washington to End the Iraq War

Jan 27, 2007 5:53 PM

Uploaded by: Joe Tresh Tags: washingtondc washington peace unitedstatesofamerica iraq protest antiwar ufpj jan27 joetresh joetreshcom jan27marchViews: 1988

Jan 27th March on Washington to End the Iraq War

Jan 27, 2007 5:32 PM

Uploaded by: Joe Tresh - Views: 1352

Jan 27th March on Washington to End the Iraq War

Jan 27, 2007 4:52 PM

Uploaded by: Joe Tresh Tags: washingtondc washington peace unitedstatesofamerica iraq protest antiwar ufpj jan27 joetresh joetreshcom jan27marchViews: 2253

Iraq Veterans Against the War

Jan 27, 2007 4:25 PM

Uploaded by: Night Heron Tags: mall march washingtondc washington peace iraq protest antiwar patriot veterans unitedforpeaceandjustice stopthemadness jan27marchViews: 2483

Jan 27th March on Washington to End the Iraq War

Jan 27, 2007 3:30 PM

Uploaded by: Joe Tresh Tags: man men washingtondc washington peace unitedstatesofamerica iraq protest antiwar ufpj jan27 joetresh joetreshcom jan27marchViews: 632

Jan 27th March on Washington to End the Iraq War

Jan 27, 2007 3:04 PM

Uploaded by: Joe Tresh Tags: march washingtondc washington war peace jan unitedstatesofamerica iraq protest antiwar end ufpj 27th jan27 jessejackson medeabenjamin timrobbins seanpenn susansarandon ...

Masgoof: Iraq's national dish

Dec 16, 2006 12:51 PM

Uploaded by: TwoCrabs - Views: 6303

iRaq - 20,000 Volts In Your Pocket - Market St

Dec 11, 2006 5:02 PM

Uploaded by: Brian McConnell Tags: sanfrancisco art apple advertising poster flyer war ipod iraq ad protest front billboard advertisement adbusters liberation guerrilla adbuster blfViews: 971

Eyes Wide Open: The Human Cost of the Iraq War @ Normal Public Library

Dec 2, 2006 4:16 PM

Uploaded by: soundfromwayout Tags: art illinois memorial peace boots iraq antiwar soldiers iraqwar eyeswideopen veterans combatboots silentprotest normalpubliclibrary peaceactivists anawesomeshot h...

Senator John Kerry (D-Mass) pissed off some folks (yet again) ... including my fellow soldiers in Iraq

Nov 9, 2006 11:41 PM

Uploaded by: violinsoldier Tags: afghanistan war peace politics iraq soldiers johnkerryViews: 3210

Protesting Iraq War. Day 6: Friday, October 20, 2006

Oct 20, 2006 4:26 PM

Uploaded by: Robin Dude Tags: people soldier justice washington bush war peace georgewbush iraq protest antiwar bellingham soldiers demonstrations protests larsen iraqwar gwbush presidentgeorgewbus...

Protesting Iraq War. Day 4: Friday, October 6, 2006

Oct 6, 2006 5:12 PM

Uploaded by: Robin Dude Tags: people bw soldier justice washington bush war peace georgewbush iraq protest antiwar bellingham soldiers demonstrations protests larsen iraqwar gwbush presidentgeorgew...

Protesting Iraq War. Day 4: Friday, October 6, 2006

Oct 6, 2006 5:11 PM

Uploaded by: Robin Dude Tags: people soldier justice washington bush war peace iran georgewbush iraq wwiii protest antiwar bellingham soldiers demonstrations protests larsen iraqwar worldwar gwbush...

Protesting Iraq War. Day 4: Friday, October 6, 2006

Oct 6, 2006 5:09 PM

Uploaded by: Robin Dude - Views: 1144

Protesting Iraq War. Day 4: Friday, October 6, 2006

Oct 6, 2006 5:04 PM

Uploaded by: Robin Dude - Views: 5252

Hedgehog, COB Speicher, Tikrit Iraq

Aug 2, 2006 8:05 PM

Uploaded by: Reuben Delarosa Tags: iraq hedgehog cob speicher tikritViews: 1187

Iraq 6

Aug 1, 2006 4:32 PM

Uploaded by: dmacks_87 Tags: soldier iraq soldiersViews: 2591

Obey "Greetings From Iraq"

Jul 29, 2006 1:50 PM

Uploaded by: Irene Roxanne (aka Irena Kittenclaw) - Views: 1180

pics from iraq 071

Jul 24, 2006 5:26 PM

Uploaded by: Tararaboomdeeay Tags: army desert iraqViews: 3116

Kurdistan: The other Iraq

Jul 21, 2006 9:47 AM

Uploaded by: Chris Kutschera - Views: 4494

Kurdistan: The other Iraq

Jul 21, 2006 7:24 AM

Uploaded by: Chris Kutschera Tags: woman church iraq young middleeast christian mass kurdistan chaldeanViews: 6059

Marines bound for Iraq

May 26, 2006 11:56 AM

Uploaded by: rcvernors Tags: usmc kids iraq camouflage americans soldiers brave troops veterans sons grunts devildog usmarines thefew youngmen semperfidelis marinecorp leatherneck wvresident thepro...

Iraq: US Marines

May 23, 2006 11:16 AM

Uploaded by: slagheap Tags: iraq fallujah usmarinesViews: 4733

iraq pre war protest 08

May 17, 2006 8:50 PM

Uploaded by: Señor Codo Tags: iraq protestViews: 1672

Iraq War Memorial, Turners Falls, Massachusetts

Apr 27, 2006 5:12 PM

Uploaded by: Jeff Wignall Tags: afghanistan america massachusetts iraq americanflag soldiers americanflags warmemorial turnersfalls wignallViews: 979

Easter in Iraq 2006

Mar 30, 2006 11:01 AM

Uploaded by: Why Not Studios Tags: easter iraq forgive antwarViews: 2735

The 1st 35 ARKANSAS MILITARY CASUALTIES IN IRAQ and AFGHANISTAN SINCE MARCH 2003

Mar 24, 2006 1:22 PM

Uploaded by: omniprotest Tags: afghanistan soldier war military iraq antiwar arkansas casualty casualtiesViews: 4446

Samerra, Imam Al-Hadi Shrine, Iraq

Mar 22, 2006 2:41 AM

Uploaded by: Hussain Shah. - Views: 1204

iraq

Mar 20, 2006 1:24 PM

Uploaded by: soldiersmediacenter Tags: soldier iraq usarmy wwwarmymil womensoldier soldiersiraq1fobkalsuViews: 3456

iraq

Mar 18, 2006 6:33 PM

Uploaded by: soldiersmediacenter Tags: usarmy wwwarmymil soldiersiraq3fobkalsuViews: 4730

Kurdistan Iraq

Mar 7, 2006 8:32 PM

Uploaded by: Chris Kutschera Tags: iraq politique kurdistan irak barzani kurds talabani moyenorient personnalite shaklawa massoudbarzani kurdes jalaltalabani azizmohammed samsahar2Views: 2372

Kurdistan Iraq

Mar 7, 2006 7:50 PM

Uploaded by: Chris Kutschera Tags: iraq guerilla kurdistan kdp irak barzani kurds pdk moyenorient massoudbarzani peshmerga kurdes pechmerga samsahar2Views: 2799

Funny Kid in Iraq

Feb 19, 2006 2:20 PM

Uploaded by: steviebreech Tags: usa kids soldier army michael interesting war king gulf iraq pop jackson michaeljackson top10interestingViews: 11487

IRAQ KUWAIT USA

Feb 2, 2006 12:22 PM

Uploaded by: mccalibur - Views: 2044

young airman crossing into iraq

Dec 21, 2005 12:01 AM

Uploaded by: Defensor Fortis Tags: life people usa proud america freedom photo interestingness interesting war pix flickr force power desert pics military air iraq picture security photographs armo...

Jungle Camo Humvee Destroyed in Iraq

Nov 25, 2005 9:56 PM

Uploaded by: aliveinbaghdad - Views: 5435

Kurdistan Iraq

Oct 27, 2005 6:09 PM

Uploaded by: Chris Kutschera - Views: 1811

Sandstorm in Iraq

Oct 4, 2005 10:00 PM

Uploaded by: tobo Tags: iraq sandstorm arabia ericfrickeViews: 4133

Iraq Casualty Map

Jun 30, 2005 9:55 PM

Uploaded by: Lance McCord Tags: america casualty composite dead google iraq map military soldier unitedstates warViews: 4948

IRAQ KUWAIT USA

May 30, 2005 3:32 PM

Uploaded by: assured16 Tags: army iraq najaf oif1Views: 3300

RUSSELL LEE KLIKA IRAQ

May 5, 2005 1:10 PM

Uploaded by: klika100 Tags: portraits tn military iraq soldiers ng usarmy rct fortcampbell 278th 101stairborne campatterbury combatphotography iraqipeople rakkasans 133cav 187infViews: 354

Sandstorm in Iraq

Apr 1, 2005 12:00 AM

Uploaded by: MobyDee Tags: iraq sandstormViews: 1852

flickr5-leaving_for_iraq

Mar 31, 2005 10:58 AM

Uploaded by: the.myrmidon - Views: 1506

FRANCE IRAQ HOSTAGES

Mar 30, 2005 1:51 PM

Uploaded by: Rollmoeps Tags: fra paris tour eiffel tower turm ballon baloons crowd peace protest iraq hostages doveViews: 1092

Tragedy in Iraq

Jan 18, 2005 9:54 AM

Uploaded by: truelovecj - Views: 2638

Iraq: Baptism

May 30, 2004 12:21 PM

Uploaded by: slagheap Tags: iraq baptism marines alasadViews: 3324

Karabala Patrol, Iraq

May 7, 2004 11:26 AM

Uploaded by: labanex Tags: war fighting operation american soldier army violent power conflict arab middleeast 1stad ironsaber iraq iraqi gun weapon civilian shooting engage combat rifle death acti...

Karabala Patrol, Iraq

May 7, 2004 9:21 AM

Uploaded by: labanex - Views: 1175

IRAQ BRAVE BATTALION (Hard Core!)

May 3, 2004 10:29 PM

Uploaded by: panzerwaffen43 - Views: 2710

Martiti fascisti in Iraq

Nov 28, 2003 3:18 PM

Uploaded by: il_Medo Tags: italy history italia shot sony politics iraq nazi police cybershot soldiers carabinieri scoop journalism 1944 1943 fascismo politica mussolini polizia repubblica giornali...

Public Domain: Marines Fire M 198 Howitzer at Umm Qasr, Iraq by MATTHEW J. DECKER USMC, 2003 (DOD 030324-M-9933D-002)

Nov 13, 2003 9:54 AM

Uploaded by: pingnews.com Tags: public soldier war unitedstates military iraq free soldiers dod royalty iraqwar americansoldiers publicdomain soliders aroundtheworld warandpeace royaltyfree operati...

Chuck Norris in Iraq

Jan 1, 1980 12:03 AM

Uploaded by: panzerwaffen43 Tags: iraq rr marines iraqwar anbar camptaqaddum mnf operationiraqifreedom mef alanbarprovince acmcViews: 2343

Asiabus and Kami on Iran/Iraq border 1966

Aug 6, 1966 4:47 am

Uploaded by: rorymac Tags: asia iran iraq 1966 trail hippie overland asiabusViews: 6654

Comments

Please Sign Up or Log In to comment.

Followers

No followers yet.